PIGB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85856

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIGB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIGB Antibody - BSA Free

PIGB Antibody - BSA Free Immunohistochemistry-Paraffin: PIGB Antibody - BSA Free [NBP1-85856]

Immunohistochemistry-Paraffin: PIGB Antibody - BSA Free [NBP1-85856]

Staining of human thyroid gland shows moderate nuclear and cytoplasmic positivity in glandular cells.
PIGB Antibody - BSA Free Western Blot: PIGB Antibody - BSA Free [NBP1-85856]

Western Blot: PIGB Antibody - BSA Free [NBP1-85856]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
PIGB Antibody - BSA Free Western Blot: PIGB Antibody - BSA Free [NBP1-85856]

Western Blot: PIGB Antibody - BSA Free [NBP1-85856]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Applications for PIGB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGB

PIGB, also referred to as GPI mannosyltransferase 3, is 554 amino acids long and is approximately 65 kDa. PIGB is a mannosyltransferase that is implicated in the biosynthesis of GPI anchors. Current research on PIGB is being performed relating to several diseases and disorders including malaria, sleeping sickness, Griscelli syndrome and encephalomalacia. PIGB has also been shown to have interactions with TMED10, CDC40, DNAJA1, FNBP1L and EEF1A1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

EC 2.4.1, EC 2.4.1.-, GPI mannosyltransferase 3, GPI mannosyltransferase III, GPI-MT-III, MGC21236, phosphatidylinositol glycan anchor biosynthesis, class B, phosphatidylinositol glycan, class B, Phosphatidylinositol-glycan biosynthesis class B protein, PIG-B

Gene Symbol

PIGB

Additional PIGB Products

Product Documents for PIGB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGB Antibody - BSA Free and earn rewards!

Have you used PIGB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies