Adenine Nucleotide Translocase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59594

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC25A4 (solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4) The peptide sequence was selected from the N terminal of SLC25A4. Peptide sequence LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Sample Tissue: Human RPMI-8226 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Immunohistochemistry: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Immunohistochemistry: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.

Applications for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenine Nucleotide Translocase 1

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

Alternate Names

AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT

Gene Symbol

SLC25A4

UniProt

Additional Adenine Nucleotide Translocase 1 Products

Product Documents for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenine Nucleotide Translocase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenine Nucleotide Translocase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenine Nucleotide Translocase 1 Antibody - BSA Free and earn rewards!

Have you used Adenine Nucleotide Translocase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...