Adenine Nucleotide Translocase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10974

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Adenine Nucleotide Translocase 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Adenine Nucleotide Translocase 1 (NP_031476.3). Peptide sequence AVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP3-10974]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP3-10974]

Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP3-10974] - Western blot analysis of Adenine Nucleotide Translocase 1 in Mouse Heart lysates. Antibody dilution at 1ug/ml

Applications for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenine Nucleotide Translocase 1

Adenine Nucleotide Translocase 1 (ANT1) catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It is is a key component of the mitochondrial permeability transition pore (PT pore) complex and is also one of the most abundant proteins in the mitochondrion making up approximately 10% of all mitochondrial proteins. Originally described as an ADP/ATP exchange factor, ANT1 has also been shown to be required for bax mediated apoptosis. This is effected by binding of bax to residues 105-156 of ANT1, presumably resulting in maintaining the PT pore in an open conformation. Interaction with bax is not required for ANT1 pro-apoptotic activity as overexpression of the ANT1 protein also leads to the induction of apoptosis.

Alternate Names

AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT

Gene Symbol

SLC25A4

Additional Adenine Nucleotide Translocase 1 Products

Product Documents for Adenine Nucleotide Translocase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenine Nucleotide Translocase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenine Nucleotide Translocase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenine Nucleotide Translocase 1 Antibody - BSA Free and earn rewards!

Have you used Adenine Nucleotide Translocase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies