AmmTX3

Catalog # Availability Size / Price Qty
5659/10U
Voltage-gated Potassium Channel Blockers Peptide
1 Image
Description: KV4 channel blocker
Product Details
Reviews (1)

Biological Activity

KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.

Technical Data

M.Wt:
3822.47
Formula:
C158H262N50O48S6
Sequence:
XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP

(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for AmmTX3

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used AmmTX3?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


AmmTX3 was used on Kv7.1 channels
By Anonymous on 01/23/2019
Species: Human

AmmTX3 was used on Kv7.1 channels to assess its blocking action with increasing temperature.


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.