Catalog Number: 2424
Biological Activity
Rat form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.
Technical Data
  • M.Wt:
    4233.76
  • Formula:
    C190H291N51O57S
  • Sequence:
    DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • Solubility:
    Soluble to 1 mg/ml in 1% Ammonia
  • Storage:
    Desiccate at -20°C
  • CAS No:
    144409-98-3
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield.
    Miguel-Hidalgo and Cacabelos
    Acta Neuropathol., 1998;95:455
  2. Neurotrophic and neurotoxic effects of amyloid beta protein: reversal by tachykinin neuropeptides.
    Yankner et al.
    Science, 1990;250:279
  3. Beta-amyloid(1-40) effects on behavior and memory.
    Cleary et al.
    Brain Res., 1995;682:69
  4. β-Amyloid protein induces platelet aggregation and supports platelet adhesion.
    Kowalska and Badellino
    Biochem.Biophys.Res.Comm., 1994;205:1829

Have you used Amyloid β-peptide (1-40) (rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information