Amyloid β-peptide (1-42) (rat)

  ( 1 citations )    
Product Datasheet
Catalog Number:2425
Chemical Name:
Product Details
Citations (1)
Reviews
Biological Activity
Rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer's disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. Neurotoxic.
Technical Data
  • M.Wt:
    4417.99
  • Formula:
    C199H307N53O59S
  • Sequence:
    DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
  • Solubility:
    Soluble to 1 mg/ml in 0.1% Ammonia
  • Storage:
    Desiccate at -20°C
  • CAS No:
    166090-74-0
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Amyloid β-peptide (1-42) (rat) include:

1 Citations: Showing 1 - 1

  1. Partial Amelioration of Synaptic and Cognitive Deficits by Inhibiting Cofilin Dephosphorylation in an Animal Model of Alzheimer's Disease
    Authors: Yulei Et al.
    Journal of Alzheimer's Disease  2016;53:1419

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used Amyloid β-peptide (1-42) (rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee