Catalog Number: 1938
Biological Activity
Human β-amyloid peptide; minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
Technical Data
  • M.Wt:
    4615.19
  • Formula:
    C207H318N56O62S
  • Sequence:
    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
  • Solubility:
    Soluble to 1 mg/ml in acetic acid
  • Storage:
    Desiccate at -20°C
  • CAS No:
    134500-80-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. The carboxy terminus of the β amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.
    Jarrett et al.
    Biochemistry, 1993;32:4693
  2. Human and rodent sequence analogs of Alzheimer's amyloid βA4 share similar properties and can be solubilized in buffers of pH 7.4.
    Hilbich et al.
    Eur.J.Biochem., 1991;201:61
  3. Mass spectrometry of purified amyloid β protein in Alzheimer's disease.
    Mori et al.
    J.Biol.Chem., 1992;267:17082

Have you used Amyloid β-Peptide (1-43) (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information