Amyloid β-peptide (42-1) (human) (CAS 317366-82-8): R&D Systems
Catalog Number: 3391
Biological Activity
Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.
Technical Data
  • M.Wt:
    4514.08
  • Formula:
    C203H311N55O60S
  • Sequence:
    AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
  • Solubility:
    Soluble to 0.50 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    317366-82-8
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Additional Information
Other Product-Specific Information:
Background References
  1. Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms.
    Walsh et al.
    Neurobiol.Dis., 2002;10:20
  2. Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina.
    Xiong et al.
    Exp.Brain Res., 2007;181:435
  3. Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease.
    Boyd-Kimball et al.
    Brain Res., 2005;1004:206
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Amyloid β-peptide (42-1) (human) include:

1 Citations: Showing 1 - 1

  1. Cannabidiol reduces Aβ-induced neuroinflammation and promotes hippocampal neurogenesis through PPARγ involvement.
    Authors: Esposito Et al.
    PLoS One 2011;6:e28668
Tocris Peptides
Description Application Cat# Citations Images  

Amyloid β-Peptide (1-42) (human)

1428 4  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Amyloid β-peptide (42-1) (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information