Bcl3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92041

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Bcl3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2). ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Bcl3 Antibody - Azide and BSA Free

Western Blot: Bcl3 AntibodyAzide and BSA Free [NBP2-92041]

Western Blot: Bcl3 AntibodyAzide and BSA Free [NBP2-92041]

Western Blot: Bcl3 Antibody [NBP2-92041] - Analysis of extracts of various cell lines, using Bcl3 antibody (NBP2-92041) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/Immunofluorescence: Bcl3 Antibody [NBP2-92041] - Immunofluorescence analysis of C6 cells using Bcl3 Rabbit pAb (NBP2-92041) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/Immunofluorescence: Bcl3 Antibody [NBP2-92041] - Analysis of NIH/3T3 cells using BCL3 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/ Immunofluorescence: Bcl3 Antibody - Azide and BSA Free [NBP2-92041]

Immunocytochemistry/Immunofluorescence: Bcl3 Antibody [NBP2-92041] - Immunofluorescence analysis of HeLa cells using Bcl3 Rabbit pAb (NBP2-92041) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for Bcl3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Bcl3

The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.

Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.

Alternate Names

B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3

Gene Symbol

BCL3

Additional Bcl3 Products

Product Documents for Bcl3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Bcl3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Bcl3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Bcl3 Antibody - Azide and BSA Free and earn rewards!

Have you used Bcl3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies