Brain natriuretic peptide (1-32) (human)

Catalog # Availability Size / Price Qty
3522/1
Brain natriuretic peptide (1-32) (human)
1 Image
Description: Endogenous peptide agonist at ANP receptor A (NPR1)
Product Details
Citations (1)
Reviews (1)

Biological Activity

Endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.

Technical Data

M.Wt:
3464.05
Formula:
C143H244N50O42S4
Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

(Modifications: Disulfide bridge between 10 - 26)

Solubility:
Soluble to 0.10 mg/ml in water
Storage:
Store at -20°C
CAS No:
124584-08-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citation for Brain natriuretic peptide (1-32) (human)

The citations listed below are publications that use Tocris products. Selected citations for Brain natriuretic peptide (1-32) (human) include:

1 Citation: Showing 1 - 1

  1. GDF15 is a heart-derived hormone that regulates body growth.
    Authors: Wang Et al.
    EMBO Mol Med  2017;9:1150

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Brain natriuretic peptide (1-32) (human)

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Brain natriuretic peptide (1-32) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


NP in vitro
By Anonymous on 08/05/2018
Species: Human

Used in vitro to investigate different roles of NP family members.


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.