GDC Antibody (1H7) - Azide and BSA Free

Novus Biologicals | Catalog # H00008034-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1H7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC25A16 (NP_689920.1, 59 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR

Specificity

Reacts with solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for GDC Antibody (1H7) - Azide and BSA Free

Western Blot: GDC Antibody (1H7) [H00008034-M01]

Western Blot: GDC Antibody (1H7) [H00008034-M01]

Western Blot: GDC Antibody (1H7) [H00008034-M01] - SLC25A16 monoclonal antibody (M01), clone 1H7. Analysis of SLC25A16 expression in HeLa.
Sandwich ELISA: GDC Antibody (1H7) [H00008034-M01] - Detection limit for recombinant GST tagged SLC25A16 is 1 ng/ml as a capture antibody.

Applications for GDC Antibody (1H7) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate for WB and recombinant protein in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GDC

This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]

Alternate Names

D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)

Entrez Gene IDs

8034 (Human)

Gene Symbol

SLC25A16

Additional GDC Products

Product Documents for GDC Antibody (1H7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GDC Antibody (1H7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GDC Antibody (1H7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GDC Antibody (1H7) - Azide and BSA Free and earn rewards!

Have you used GDC Antibody (1H7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...