NHLH1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93392

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1). MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NHLH1 Antibody - Azide and BSA Free

NHLH1 Antibody - Azide and BSA Free

Immunoprecipitation: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] -

Immunoprecipitation: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] - Immunoprecipitation analysis of 300ug extracts of 293F-NHLH1-Avi-His(C) cells using 3ug NHLH1 Rabbit pAb. Western blot was performed from the immunoprecipitate using NHLH1 Rabbit pAb antibody at a dilition of 1:3000.
NHLH1 Antibody - Azide and BSA Free

Western Blot: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] -

Western Blot: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with NHLH1 using NHLH1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
NHLH1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] -

Immunocytochemistry/ Immunofluorescence: NHLH1 Antibody - Azide and BSA Free [NBP2-93392] - Immunofluorescence analysis of 293F cells transfected with NHLH1 using NHLH1 Rabbit pAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for NHLH1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NHLH1

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]

Alternate Names

BHLHA35, bHLHa35HEN-1, helix-loop-helix protein 1, HEN1NSCL-1, nescient helix loop helix 1Class A basic helix-loop-helix protein 35, NSCL, NSCL1

Gene Symbol

NHLH1

Additional NHLH1 Products

Product Documents for NHLH1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NHLH1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NHLH1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NHLH1 Antibody - Azide and BSA Free and earn rewards!

Have you used NHLH1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...