Catalog Number: 3011
Alternate Names: PTH 1-34, hPTH (1-34), Teriparatide
Biological Activity
Human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.
Technical Data
  • M.Wt:
    4117.75
  • Formula:
    C181H291N55O51S2
  • Sequence:
    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
  • Solubility:
    Soluble to 0.40 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    52232-67-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats.
    Dobnig and Turner
    Endocrinology, 1997;138:4607
  2. Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys.
    Manabe et al.
    Bone, 2007;40:1475
  3. The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone.
    Niall et al.
    Proc.Natl.Acad.Sci., 1974;71:384

Have you used Parathyroid hormone (1-34) (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information