Catalog Number: 6301
Biological Activity
Parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.
Technical Data
  • M.Wt:
    4057.74
  • Formula:
    C180H291N55O48S2
  • Sequence:
    AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    98614-76-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Inhibition of osteoclast function reduces hematopoietic stem cell numbers in vivo.
    Lymperi et al.
    Blood., 2017;117:1540
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information