SLC25A10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83541

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC25A10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A10. Peptide sequence: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC25A10 Antibody - BSA Free

Western Blot: SLC25A10 Antibody [NBP2-83541]

Western Blot: SLC25A10 Antibody [NBP2-83541]

Western Blot: SLC25A10 Antibody [NBP2-83541] - WB Suggested Anti-SLC25A10 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

Applications for SLC25A10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A10

The mitochondrial dicarboxylate carrier protein (mDIC) belongs to superfamily of mitochondrial transporters. It has been demonstrated that the expression of mDIC leads to hyperpolarization of the mitochondria, as well as succinate uptake by the mitochondria. It is highly expressed in adipose tissue, where its expression is downregulated by insulin and upregulated by free fatty acids. mDIC is also thought to play a role in glyceroneogenesis.

Alternate Names

dicarboxylate ion carrier, DICSolute carrier family 25 member 10, member 10, mitochondrial dicarboxylate carrier, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter)

Gene Symbol

SLC25A10

Additional SLC25A10 Products

Product Documents for SLC25A10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A10 Antibody - BSA Free and earn rewards!

Have you used SLC25A10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies