SLC26A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49271

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC26A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC26A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Analysis in human colon and liver tissues using NBP2-49271antibody. Corresponding SLC26A2 RNA-seq data are presented for the same tissues.
Western Blot: SLC26A2 Antibody [NBP2-49271]

Western Blot: SLC26A2 Antibody [NBP2-49271]

Western Blot: SLC26A2 Antibody [NBP2-49271] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human colon shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271]

Immunohistochemistry-Paraffin: SLC26A2 Antibody [NBP2-49271] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for SLC26A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A2

The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.

Alternate Names

D5S1708, Diastrophic dysplasia protein, diastrophic dysplasia sulfate transporter, DTDMSTP157, DTDSTMST153, EDM4, solute carrier family 26 (sulfate transporter), member 2, Solute carrier family 26 member 2, sulfate anion transporter 1, sulfate transporter

Gene Symbol

SLC26A2

Additional SLC26A2 Products

Product Documents for SLC26A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC26A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC26A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC26A2 Antibody - BSA Free and earn rewards!

Have you used SLC26A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies