TCFL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49174

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI

Reactivity Notes

Mouse (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TCFL5 Antibody - BSA Free

Western Blot: TCFL5 Antibody [NBP2-49174]

Western Blot: TCFL5 Antibody [NBP2-49174]

Western Blot: TCFL5 Antibody [NBP2-49174] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: TCFL5 Antibody [NBP2-49174]

Immunocytochemistry/ Immunofluorescence: TCFL5 Antibody [NBP2-49174]

Immunocytochemistry/Immunofluorescence: TCFL5 Antibody [NBP2-49174] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: TCFL5 Antibody [NBP2-49174]

Western Blot: TCFL5 Antibody [NBP2-49174]

Western Blot: TCFL5 Antibody [NBP2-49174] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Analysis in human testis and pancreas tissues. Corresponding TCFL5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human rectum shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174]

Immunohistochemistry-Paraffin: TCFL5 Antibody [NBP2-49174] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Applications for TCFL5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCFL5

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Alternate Names

bHLHe82, CHA, Cha transcription factor, CHAMGC46135, E2BP1, E2BP-1HPV-16 E2 binding protein 1, Figlb, HPV-16 E2-binding protein 1, transcription factor-like 5 (basic helix-loop-helix), transcription factor-like 5 protein

Gene Symbol

TCFL5

Additional TCFL5 Products

Product Documents for TCFL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TCFL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TCFL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TCFL5 Antibody - BSA Free and earn rewards!

Have you used TCFL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...