TSGA14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TSGA14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TSGA14. Peptide sequence: IATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFEN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TSGA14 Antibody - BSA Free

Western Blot: TSGA14 Antibody [NBP2-86016]

Western Blot: TSGA14 Antibody [NBP2-86016]

Western Blot: TSGA14 Antibody [NBP2-86016] - Host: Rabbit. Target Name: CEP41. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TSGA14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSGA14

CEP41 (centrosomal protein of 41 kDa) is the protein product of the testis-specific gene A14 (TSGA14). TSGA14 was originally identified as a gene adjacent to the imprinted gene MEST. Studies of TSGA14 revealed that unlike MEST, TSGA14 is not an imprinted gene. CEP41 was also identified as a true centrosomal protein in a mass-spectometry-based proteomic analysis of human centrosomes. The role of CEP41 in the centrosome remains uncharacterized

Alternate Names

centrosomal protein 41 kDa, centrosomal protein of 41 kDa, CEP41, DKFZp762H1311, testis specific protein A14, testis specific, 14, Testis-specific gene A14 protein

Gene Symbol

CEP41

Additional TSGA14 Products

Product Documents for TSGA14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSGA14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSGA14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSGA14 Antibody - BSA Free and earn rewards!

Have you used TSGA14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies