26S proteasome subunit 9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47561

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 26S proteasome subunit 9 Antibody - BSA Free

Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561]

Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561]

Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunocytochemistry/ Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human skin using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney, liver, skin and testis using Anti-PSMD9 antibody NBP2-47561 (A) shows similar protein distribution across tissues to independent antibody NBP2-47560(B).
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human liver using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561]

Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human testis using Anti-PSMD9 antibody.

Applications for 26S proteasome subunit 9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 26S proteasome subunit 9

Alternate Names

26S proteasome non-ATPase regulatory subunit 9, p27, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, Rpn4

Gene Symbol

PSMD9

Additional 26S proteasome subunit 9 Products

Product Documents for 26S proteasome subunit 9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 26S proteasome subunit 9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 26S proteasome subunit 9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 26S proteasome subunit 9 Antibody - BSA Free and earn rewards!

Have you used 26S proteasome subunit 9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...