6 Phosphofructo 2 Kinase Antibody (7X10D9)

Novus Biologicals | Catalog # NBP3-16295

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7X10D9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human 6 Phosphofructo 2 Kinase (NP_004557.1). LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for 6 Phosphofructo 2 Kinase Antibody (7X10D9)

Western Blot: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295]

Western Blot: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295]

Western Blot: 6 Phosphofructo 2 Kinase Antibody (7X2H3) [NBP3-16295] - Western blot analysis of extracts of various cell lines, using 6 Phosphofructo 2 Kinase Rabbit mAb (NBP3-16295) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
6 Phosphofructo 2 Kinase Antibody (7X10D9)

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] -

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using 6 Phosphofructo 2 Kinase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
6 Phosphofructo 2 Kinase Antibody (7X10D9)

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] -

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using 6 Phosphofructo 2 Kinase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
6 Phosphofructo 2 Kinase Antibody (7X10D9)

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] -

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using 6 Phosphofructo 2 Kinase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
6 Phosphofructo 2 Kinase Antibody (7X10D9)

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] -

Immunohistochemistry: 6 Phosphofructo 2 Kinase Antibody (7X10D9) [NBP3-16295] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using 6 Phosphofructo 2 Kinase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for 6 Phosphofructo 2 Kinase Antibody (7X10D9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 -1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PFKFB3

Synthesis and degradation of fructose 2,6-bisphosphate

Long Name

6-Phosphofructo-2-Kinase/ Fructose-2,6-Bisphosphatase

Alternate Names

6 Phosphofructo 2 Kinase, IPFK2, PFK/FBPase 3, PFK2

Gene Symbol

PFKFB3

Additional PFKFB3 Products

Product Documents for 6 Phosphofructo 2 Kinase Antibody (7X10D9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 6 Phosphofructo 2 Kinase Antibody (7X10D9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 6 Phosphofructo 2 Kinase Antibody (7X10D9)

There are currently no reviews for this product. Be the first to review 6 Phosphofructo 2 Kinase Antibody (7X10D9) and earn rewards!

Have you used 6 Phosphofructo 2 Kinase Antibody (7X10D9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...