Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

Novus Biologicals | Catalog # NBP3-15744

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5J4W7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of Mouse heart, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunoprecipitation: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744]

Immunoprecipitation: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of 300ug extracts of HepG2 cells using 3ug Acetyl-CoA Carboxylase alpha/ACACA antibody (NBP3-15744). Western blot was performed from the immunoprecipitate using Acetyl-CoA Carboxylase alpha/ACACA (NBP3-15744) at a dilition of 1:1000.

Applications for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug-4ug antibody for 200ug-400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Acetyl-CoA Carboxylase alpha/ACACA

Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).

Long Name

Acetyl-Coenzyme A Carboxylase alpha

Alternate Names

ACACA, ACC1, ACCA, AcetylCoA Carboxylase alpha

Gene Symbol

ACACA

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Product Documents for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)

There are currently no reviews for this product. Be the first to review Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) and earn rewards!

Have you used Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...