ADAMTS18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57095

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif, 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAMTS18 Antibody - BSA Free

Western Blot: ADAMTS18 Antibody [NBP1-57095]

Western Blot: ADAMTS18 Antibody [NBP1-57095]

Western Blot: ADAMTS18 Antibody [NBP1-57095] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for ADAMTS18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTS18

ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Alternate Names

A disintegrin and metalloproteinase with thrombospondin motifs 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21, ADAM metallopeptidase with thrombospondin type 1 motif, 18, ADAM-TS 18, ADAM-TS18, ADAMTS-18, ADAMTS21, disintegrin and metalloprotease-like protein, EC 3.4.24.-, EC 3.4.24.82

Gene Symbol

ADAMTS18

UniProt

Additional ADAMTS18 Products

Product Documents for ADAMTS18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADAMTS18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAMTS18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTS18 Antibody - BSA Free and earn rewards!

Have you used ADAMTS18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...