Adenosine A1R Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-77764

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Adenosine A1R Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN

Reactivity Notes

Mouse (89%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Adenosine A1R Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Adenosine A1R

Adenosine receptors (ARs) are members of the 7-transmembrane domain G-protein-coupled receptor superfamily. Structural, biochemical and pharmacological analyses of the AR genes and protein has led to the discovery of four distinct AR subtypes (A1, A2a, A2b, A3). Activation of ARs mediates several receptor subtype-specific physiological processes that include cardiac rate, smooth muscle tone, platelet aggregation, inflammation, cell growth and death, and neurotransmission.The A1AR is a glycoprotein that can activate Gi and Go proteins in vitro. In intact cells, agonist occupation of the A1AR has been shown to cause pertussis toxin-sensitive inhibition of adenylyl cyclase activity and, in some systems, a stimulation of phospholipase C resulting in mobilization of intracellular calcium stores. Activation of potassium channels by A1AR has been intensively studied in relation to its dramatic effects on the cardiovascular system. A1AR protein is highly expressed in brain (especially cerebellum, hippocampus, thalamus, and cortex) and spinal cord and in part, modulates neurotransmitter release. In white adipocytes A1AR inhibits lipolysis and stimulates glucose uptake. Other tissues also express A1AR including kidney and testis.

Long Name

Adenosine A1 Receptor

Alternate Names

Adenosine A1 R, ADORA1, RDC7

Gene Symbol

ADORA1

Additional Adenosine A1R Products

Product Documents for Adenosine A1R Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenosine A1R Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosine A1R Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Adenosine A1R Antibody [Biotin] and earn rewards!

Have you used Adenosine A1R Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies