ADPGK Antibody (1E4) - Azide and BSA Free
Novus Biologicals | Catalog # H00083440-M01
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Knockout Validated, Western Blot, ELISA, Sandwich ELISA, Knockdown Validated
Cited:
Knockout Validated, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 1E4
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Specificity
ADPGK - ADP-dependent glucokinase
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for ADPGK Antibody (1E4) - Azide and BSA Free
Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in NIH/3T3.Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi ( Cat # H00083440-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody (M01), clone 1E4 (Cat # H00083440-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4 Analysis of ADPGK expression in HeLa.Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in PC-12.Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - ADPGK monoclonal antibody (M01), clone 1E4. Analysis of ADPGK expression in Raw 264.7.Western Blot: ADPGK Antibody (1E4) [H00083440-M01]
Western Blot: ADPGK Antibody (1E4) [H00083440-M01] - Analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4.Lane 1: ADPGK transfected lysate(54.1 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: ADPGK Antibody (1E4) [H00083440-M01] - Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.
Applications for ADPGK Antibody (1E4) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. Knock Out Validation was reported in scientific literature (PMID: 23799003).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ADPGK
Alternate Names
ADP-dependent glucokinase, ADP-GKrbBP-35, ATP-dependent glucokinase, DKFZp434B195, EC 2.7.1.147,2610017G09Rik, RbBP-35
Entrez Gene IDs
83440 (Human)
Gene Symbol
ADPGK
UniProt
Additional ADPGK Products
Product Documents for ADPGK Antibody (1E4) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ADPGK Antibody (1E4) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ADPGK Antibody (1E4) - Azide and BSA Free
Customer Reviews for ADPGK Antibody (1E4) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ADPGK Antibody (1E4) - Azide and BSA Free and earn rewards!
Have you used ADPGK Antibody (1E4) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...