AHRR Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10508

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AHRR (NP_065782). Peptide sequence LPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AHRR Antibody - BSA Free

Western Blot: AHRR Antibody [NBP3-10508]

Western Blot: AHRR Antibody [NBP3-10508]

Western Blot: AHRR Antibody [NBP3-10508] - Western blot analysis using NBP3-10508 on Human HepG2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for AHRR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AHRR

AHRR, or Aryl hydrocarbon receptor repressor, contains a 76 kDa, 78 kDa, and 77 kDa isoform, and mediates and regulates cell growth, transcription activity, and differentiation. Disease research is currently being conducted on AHRR and its relation to a variety of disorders and diseases, including dysgammaglobulinemia, ovarian cystadenoma, esophageal squamous cell carcinoma, male infertility, laryngitis, hepatitis, endometriosis, pulmonary disease, azoosperima, lung cancer, fibrosis, and esophagitis. This protein interacts with HDAC4, ANKRA2, ARNT, ESR1, and HADC5 in the AHR Pathway.

Alternate Names

AHH, AHHR, AhR repressor, AhRR, aryl hydrocarbon receptor regulator, aryl hydrocarbon receptor repressor, arylhydrocarbon receptor repressor, aryl-hydrocarbon receptor repressor, BHLHE77, Class E basic helix-loop-helix protein 77, dioxin receptor repressor, KIAA1234bHLHe77aryl hydrocarbon hydroxylase regulator, MGC167813, MGC176630

Gene Symbol

AHRR

Additional AHRR Products

Product Documents for AHRR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AHRR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AHRR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AHRR Antibody - BSA Free and earn rewards!

Have you used AHRR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...