AK3L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48773

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD

Reactivity Notes

Mouse (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AK3L1 Antibody - BSA Free

Western Blot: AK3L1 Antibody [NBP2-48773]

Western Blot: AK3L1 Antibody [NBP2-48773]

Western Blot: AK3L1 Antibody [NBP2-48773] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human pancreas using Anti-AK4 antibody NBP2-48773.
Immunohistochemistry: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry: AK3L1 Antibody [NBP2-48773] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining in human kidney and pancreas tissues using anti-AK4 antibody. Corresponding AK4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human kidney, liver, lymph node and pancreas using Anti-AK4 antibody NBP2-48773 (A) shows similar protein distribution across tissues to independent antibody NBP2-47553 (B).
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human liver.
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human lymph node.
Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773]

Immunohistochemistry-Paraffin: AK3L1 Antibody [NBP2-48773] - Staining of human kidney using Anti-AK4 antibody NBP2-48773.

Applications for AK3L1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AK3L1

AK3L1 encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.

Long Name

Adenylate kinase 4, mitochondrial

Alternate Names

AK 4, AK3, AK4

Gene Symbol

AK4

Additional AK3L1 Products

Product Documents for AK3L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AK3L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AK3L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AK3L1 Antibody - BSA Free and earn rewards!

Have you used AK3L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...