ALDH18A1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83324
![Western Blot: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Western-Blot-NBP1-83324-img0018.jpg "Western Blot: ALDH18A1 Antibody [NBP1-83324]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ALDH18A1 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83324-img0011.jpg "Immunocytochemistry/ Immunofluorescence: ALDH18A1 Antibody [NBP1-83324]")
Immunocytochemistry/ Immunofluorescence: ALDH18A1 Antibody [NBP1-83324]
Immunocytochemistry/Immunofluorescence: ALDH18A1 Antibody [NBP1-83324] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0017.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]")
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0014.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]")
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0015.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]")
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]](https://resources.rndsystems.com/images/products/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0016.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]")
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324]
Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human liver shows no positivity in hepatocytes as expected.![ALDH18A1 Antibody - BSA Free Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]](https://resources.rndsystems.com/images/products/nbp1-83324_rabbit-polyclonal-aldh18a1-antibody-84202516574438.jpg "Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]")
Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.![ALDH18A1 Antibody - BSA Free Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]](https://resources.rndsystems.com/images/products/nbp1-83324_rabbit-polyclonal-aldh18a1-antibody-8420251719564.jpg "Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]")
Western Blot: ALDH18A1 Antibody - BSA Free [NBP1-83324]
Analysis in human cell line HepG2.Applications for ALDH18A1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ALDH18A1
Alternate Names
aldehyde dehydrogenase 18 family, member A1, Aldehyde dehydrogenase family 18 member A1, delta-1-pyrroline-5-carboxylate synthase, EC 2.1.2.11, EC 2.3.3.13, GSASdelta1-pyrroline-5-carboxlate synthetase, MGC117316, P5CSdelta-1-pyrroline-5-carboxylate synthetase, PYCSEC 1.2.1.41, pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase)
Entrez Gene IDs
5832 (Human)
Gene Symbol
ALDH18A1
UniProt
Additional ALDH18A1 Products
Product Documents for ALDH18A1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ALDH18A1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ALDH18A1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for ALDH18A1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ALDH18A1 Antibody - BSA Free and earn rewards!
Have you used ALDH18A1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for ALDH18A1 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I am looking for mouse Aldh18a1 antibody suitable for immunohistochemistry, and find your antibodies NBP1-83324 and NBP1-83325. Do you have the data of WB or IHC using these antibodies against mouse samples? If not, I would like to test them in our samples. It would be great if you could give us an aliquot of them, and we will let you know the outcomes.
A:
For our two products NBP1-83324 and NBP1-83325, we have not yet tested these products for detection of the mouse protein. I did run alignments of our antigens against the mouse sequence. Both sequences have a high homology to the mouse sequence. Since we have not yet tested these against mouse samples, you would qualify for our Innovator's Reward program. In exchange for a review of these products in your experiment, we would issue you a credit for the purchase price of the antibody. Regardless of results. Due to our Innovator's Reward Program, we do not offer free aliquots of our products. I am sorry for any inconvenience.
Loading...