ALDH7A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38572

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).

Sequence:
APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALDH7A1 Antibody - BSA Free

ALDH7A1 Antibody

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] -

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ALDH7A1 Rabbit pAb at a dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ALDH7A1 Antibody

Western Blot: ALDH7A1 Antibody [NBP3-38572] -

Western Blot: ALDH7A1 Antibody [NBP3-38572] - Western blot analysis of various lysates, using ALDH7A1 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Negative control (NC): K-562.
Exposure time: 75s.
ALDH7A1 Antibody

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] -

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] - Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded rat heart tissue using ALDH7A1 Rabbit pAb at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ALDH7A1 Antibody

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] -

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] - Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded mouse colon tissue using ALDH7A1 Rabbit pAb at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ALDH7A1 Antibody

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] -

Immunohistochemistry: ALDH7A1 Antibody [NBP3-38572] - Immunohistochemistry analysis of ALDH7A1 in paraffin-embedded human kidney tissue using ALDH7A1 Rabbit pAb at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for ALDH7A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ALDH7A1

Antiquitin (Aldh7a1) is an evolutionarily conserved protein believed to play a role in the regulation of cellular turgor. Based on sequence analysis, this protein is classified as a member of the aldehyde dehydrogenase superfamily (1). Analysis of the amount of mRNA in various rat and human tissues indicates that the largest amounts are found in rat kidney and liver and in cultured human hepatoma cells. Only minimal amounts were detected in human peripheral blood leukocytes, rat lung, or cultured human fibroblasts (2). The plant homolog of ATQ1 is thought to be involved in regulating turgor pressure, a function that also would be essential for cells of the mammalian cochlea. Northern blots of 13 human fetal tissues show antiquitin to be highly expressed in cochlea, ovary, eye, heart, and kidney (3).

Alternate Names

aldehyde dehydrogenase 7 family, member A1, Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog, Alpha-AASA dehydrogenase, ATQ1Antiquitin-1, Betaine aldehyde dehydrogenase, Delta1-piperideine-6-carboxylate dehydrogenase, EC 1.2.1, EC 1.2.1.3, EC 1.2.1.31, EC 1.2.1.8, EPDalpha-aminoadipic semialdehyde dehydrogenase, FLJ11738, FLJ92814, P6c dehydrogenase, PDEantiquitin-1

Gene Symbol

ALDH7A1

Additional ALDH7A1 Products

Product Documents for ALDH7A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALDH7A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALDH7A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALDH7A1 Antibody - BSA Free and earn rewards!

Have you used ALDH7A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...