alpha-Defensin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05562

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alpha-Defensin 1 Antibody - BSA Free

Western Blot: alpha-Defensin 1 AntibodyAzide and BSA Free [NBP3-05562]

Western Blot: alpha-Defensin 1 AntibodyAzide and BSA Free [NBP3-05562]

Western Blot: alpha-Defensin 1 Antibody [NBP3-05562] - Analysis of extracts of various cell lines, using DEFA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
alpha-Defensin 1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: alpha-Defensin 1 Antibody - Azide and BSA Free [alpha-Defensin 1] -

Immunocytochemistry/ Immunofluorescence: alpha-Defensin 1 Antibody - Azide and BSA Free [alpha-Defensin 1] - Immunofluorescence analysis of Jurkat cells using alpha-Defensin 1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for alpha-Defensin 1 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Defensin 1

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundantin the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine,respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequenceand distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8.The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likelyplays a role in phagocyte-mediated host defense. It differs from defensin, alpha 3 by only one amino acid. (providedby RefSeq)

Alternate Names

alphaDefensin 1, DEF1, DEFA1, HNP-1, HP1, MRS

Gene Symbol

DEFA1

Additional alpha-Defensin 1 Products

Product Documents for alpha-Defensin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-Defensin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for alpha-Defensin 1 Antibody - BSA Free

Customer Reviews for alpha-Defensin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha-Defensin 1 Antibody - BSA Free and earn rewards!

Have you used alpha-Defensin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...