alpha-Internexin Antibody (5E5Z3)
Novus Biologicals | Catalog # NBP3-16230
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5E5Z3 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human alpha-Internexin (Q16352). EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for alpha-Internexin Antibody (5E5Z3)
Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]
Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Western blot analysis of extracts of various cell lines, using alpha-Internexin Rabbit mAb (NBP3-16230) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded mouse brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human appendix tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded rat brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human colon tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded mouse brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -
Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded rat brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for alpha-Internexin Antibody (5E5Z3)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: alpha-Internexin
The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.
Alternate Names
alphaInternexin, INA, NEF5, NF-66, TXBP-1
Gene Symbol
INA
Additional alpha-Internexin Products
Product Documents for alpha-Internexin Antibody (5E5Z3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for alpha-Internexin Antibody (5E5Z3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for alpha-Internexin Antibody (5E5Z3)
There are currently no reviews for this product. Be the first to review alpha-Internexin Antibody (5E5Z3) and earn rewards!
Have you used alpha-Internexin Antibody (5E5Z3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...