ALX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83931

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat ALX3. Peptide sequence: FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ALX3 Antibody - BSA Free

Western Blot: ALX3 Antibody [NBP2-83931]

Western Blot: ALX3 Antibody [NBP2-83931]

Western Blot: ALX3 Antibody [NBP2-83931] - WB Suggested Anti-Alx3 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Thymus

Applications for ALX3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALX3

Aristaless-related genes are a group of paired-related homeobox genes which play a role in regulating vertebrate embryogenesis. The homeodomain transciption factor aristaless-like 3 (ALX3) is expressed in mouse embryos from 8 days of gestation, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. Expression analysis of human and mouse tissue reveals predominant ALX3 expression in brain tissue. The Alx3 gene maps to chromosome 1p23-p13 and encodes a 343 amino acid protein. Preferential methylation of Alx3 occurs in advanced-stage neuroblastoma and may repress ALX3 expression. Treatment with the methylation inhibitor 5-aza-2'-deoxycytidine restores ALX3 expression. Alx3 (-) mice lack a phenotype distinct from wild-type mice, however Alx3/Alx4 double mutants demonstrate severe craniofacial abnormalities not present in Alx4 single mutants. Specifically, Alx3/Alx4 double mutant newborn mice have cleft nasal regions in addition to malformation of other neural crest-derived skull structures.

Alternate Names

ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3

Gene Symbol

ALX3

Additional ALX3 Products

Product Documents for ALX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALX3 Antibody - BSA Free and earn rewards!

Have you used ALX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...