AMPK gamma 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38409

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human AMPK gamma 1 (NP_002724.1).

Sequence:
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AMPK gamma 1 Antibody - BSA Free

AMPK gamma 1 Antibody

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] -

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] - Immunohistochemistry analysis of paraffin-embedded Rat brain using AMPK gamma 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AMPK gamma 1 Antibody

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] -

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] - Immunohistochemistry analysis of paraffin-embedded Human stomach using AMPK gamma 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AMPK gamma 1 Antibody

Immunocytochemistry/ Immunofluorescence: AMPK gamma 1 Antibody [NBP3-38409] -

Immunocytochemistry/ Immunofluorescence: AMPK gamma 1 Antibody [NBP3-38409] - Immunofluorescence analysis of MCF-7 cells using AMPK gamma 1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
AMPK gamma 1 Antibody

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] -

Immunohistochemistry: AMPK gamma 1 Antibody [NBP3-38409] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using AMPK gamma 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AMPK gamma 1 Antibody

Western Blot: AMPK gamma 1 Antibody [NBP3-38409] -

Western Blot: AMPK gamma 1 Antibody [NBP3-38409] - Western blot analysis of various lysates using AMPK gamma 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.

Applications for AMPK gamma 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AMPK gamma 1

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1), is a heterotrimeric protein comprise of alpha (63 kDa), beta (30 kDa) and gamma (38 kDa) subunits. The alpah subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits (although they have been found to interact with the active subunit in liver). AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (2). AMPK is activated by AMP and can be also regulated by treatment with purified protein phosphatase in vitro (3).

Long Name

AMP-activated Protein Kinase gamma 1

Alternate Names

AMPKG, AMPKG1, PRKAG1

Gene Symbol

PRKAG1

Additional AMPK gamma 1 Products

Product Documents for AMPK gamma 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AMPK gamma 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for AMPK gamma 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK gamma 1 Antibody - BSA Free and earn rewards!

Have you used AMPK gamma 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...