Apolipoprotein L1 Antibody (1A8N2)

Novus Biologicals | Catalog # NBP3-16407

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1A8N2 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human Apolipoprotein L1 (O14791). RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apolipoprotein L1 Antibody (1A8N2)

Western Blot: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407]

Western Blot: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407]

Western Blot: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407] - Western blot analysis of extracts of various cell lines, using Apolipoprotein L1 Rabbit mAb (NBP3-16407) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Apolipoprotein L1 Antibody (1A8N2)

Immunocytochemistry/ Immunofluorescence: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407] -

Immunocytochemistry/ Immunofluorescence: Apolipoprotein L1 Antibody (1A8N2) [NBP3-16407] - Confocal imaging of Hep G2 cells using Apolipoprotein L1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Apolipoprotein L1 Antibody (1A8N2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein L1/APOL1

Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein L gene family encodes six highly homologous proteins designated apoL-I to -VI, which are associated with large high density type lipoproteins (HDL). The human apoL family maps to chromosome 22q12.1- 13.1 within a 127,000-bp region. apoL has been characterized as a pancreas specific, 383-amino acid, 42 kDa protein that contains a 12-amino acid secretory signal peptide. The apoL genes have TATA-less promoters and contain putative sterol regulatory elements, suggesting that transcription of these genes may be coordinated with that of the low density lipoprotein receptor and genes in pathways involving the synthesis of triglycerides and cholesterol. apoL homologs can undergo 10 fold changes in expression during atherosclerotic changes in vascular endothelial cells, which includes the inflammatory reaction of atherosclerotic lesions.

Long Name

Apolipoprotein L1

Alternate Names

APO-L, APO-L1, APO-LI, APOL, APOL1, FSGS4

Gene Symbol

APOL1

Additional Apolipoprotein L1/APOL1 Products

Product Documents for Apolipoprotein L1 Antibody (1A8N2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein L1 Antibody (1A8N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Apolipoprotein L1 Antibody (1A8N2)

There are currently no reviews for this product. Be the first to review Apolipoprotein L1 Antibody (1A8N2) and earn rewards!

Have you used Apolipoprotein L1 Antibody (1A8N2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...