Aquaporin 1/AQP1 Antibody (8V1O3)

Novus Biologicals | Catalog # NBP3-16354

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8V1O3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 170-269 of human Aquaporin-1 (Aquaporin 1/AQP1) (P29972). LAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin 1/AQP1 Antibody (8V1O3)

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Western blot analysis of extracts of Mouse liver, using Aquaporin-1 (Aquaporin 1/AQP1) Rabbit mAb (NBP3-16354) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Western blot analysis of extracts of various cell lines, using Aquaporin-1 (Aquaporin 1/AQP1) Rabbit mAb (NBP3-16354) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Aquaporin 1/AQP1 Antibody (8V1O3)

Immunohistochemistry: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] -

Immunohistochemistry: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Aquaporin-1 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Aquaporin 1/AQP1 Antibody (8V1O3)

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] -

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Confocal imaging of paraffin-embedded Human colon cancer tissue using Aquaporin-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Aquaporin 1/AQP1 Antibody (8V1O3)

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] -

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Confocal imaging of paraffin-embedded Mouse brain tissue using Aquaporin-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for Aquaporin 1/AQP1 Antibody (8V1O3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:500 - 1:2000

Immunohistochemistry-Paraffin

1:500 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin 1/AQP1

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)

Alternate Names

AQP1, CHIP28, CO

Gene Symbol

AQP1

Additional Aquaporin 1/AQP1 Products

Product Documents for Aquaporin 1/AQP1 Antibody (8V1O3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin 1/AQP1 Antibody (8V1O3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Aquaporin 1/AQP1 Antibody (8V1O3)

There are currently no reviews for this product. Be the first to review Aquaporin 1/AQP1 Antibody (8V1O3) and earn rewards!

Have you used Aquaporin 1/AQP1 Antibody (8V1O3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin 1/AQP1 Antibody (8V1O3)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.

    A:

    A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...