ARFIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87255

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARFIP2 Antibody - BSA Free

Western Blot: ARFIP2 Antibody [NBP1-87255]

Western Blot: ARFIP2 Antibody [NBP1-87255]

Western Blot: ARFIP2 Antibody [NBP1-87255] - Analysis in control (vector only transfected HEK293T lysate) and ARFIP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ARFIP2 Antibody [NBP1-87255]

Immunocytochemistry/ Immunofluorescence: ARFIP2 Antibody [NBP1-87255]

Immunocytochemistry/Immunofluorescence: ARFIP2 Antibody [NBP1-87255] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and golgi apparatus. Antibody staining is shown in green.
ARFIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Analysis in human prostate and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.
ARFIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
ARFIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Staining of human liver shows no positivity in hepatocytes as expected.
ARFIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
ARFIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Immunohistochemistry-Paraffin: ARFIP2 Antibody [NBP1-87255]

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Applications for ARFIP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARFIP2

Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling

Alternate Names

ADP-ribosylation factor interacting protein 2, ADP-ribosylation factor-interacting protein 2, arfaptin 2, arfaptin-2, Partner of RAC1, POR1partner of RAC1 (arfaptin 2), Protein POR1

Entrez Gene IDs

23647 (Human)

Gene Symbol

ARFIP2

UniProt

Additional ARFIP2 Products

Product Documents for ARFIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARFIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARFIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARFIP2 Antibody - BSA Free and earn rewards!

Have you used ARFIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...