Argininosuccinate Synthase Antibody (4W1M8)

Novus Biologicals | Catalog # NBP3-16749

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4W1M8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Argininosuccinate Synthase (P00966). MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIAR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Argininosuccinate Synthase Antibody (4W1M8)

Western Blot: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749]

Western Blot: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749]

Western Blot: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749] - Western blot analysis of extracts of various cell lines, using Argininosuccinate Synthase Rabbit mAb (NBP3-16749) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749]

Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749]

Immunocytochemistry/Immunofluorescence: Argininosuccinate Synthase Antibody (4W1M8) [NBP3-16749] - Immunofluorescence analysis of NIH-3T3 cells using Argininosuccinate Synthase Rabbit mAb (NBP3-16749) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Argininosuccinate Synthase Antibody (4W1M8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Argininosuccinate Synthase

Argininosuccinate Synthase is encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of Argininosuccinate Synthase cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Alternate Names

argininosuccinate synthase, argininosuccinate synthase 1, argininosuccinate synthetase, argininosuccinate synthetase 1, ASSCTLN1, citrulline-aspartate ligase, Citrulline--aspartate ligase, EC 6.3.4.5

Gene Symbol

ASS1

Additional Argininosuccinate Synthase Products

Product Documents for Argininosuccinate Synthase Antibody (4W1M8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Argininosuccinate Synthase Antibody (4W1M8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Argininosuccinate Synthase Antibody (4W1M8)

There are currently no reviews for this product. Be the first to review Argininosuccinate Synthase Antibody (4W1M8) and earn rewards!

Have you used Argininosuccinate Synthase Antibody (4W1M8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...