Arginyl tRNA synthetase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38241

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Arginyl tRNA synthetase (NP_002878.2).

Sequence:
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Arginyl tRNA synthetase Antibody - BSA Free

Arginyl tRNA synthetase Antibody

Western Blot: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Western Blot: Arginyl tRNA synthetase Antibody [NBP3-38241] - Western blot analysis of various lysates, using Arginyl tRNA synthetase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Arginyl tRNA synthetase Antibody

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Arginyl tRNA synthetase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Arginyl tRNA synthetase Antibody

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Arginyl tRNA synthetase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Arginyl tRNA synthetase Antibody

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Immunohistochemistry: Arginyl tRNA synthetase Antibody [NBP3-38241] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Arginyl tRNA synthetase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Arginyl tRNA synthetase Antibody

Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP3-38241] - Immunofluorescence analysis of NIH/3T3 cells using Arginyl tRNA synthetase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Arginyl tRNA synthetase Antibody

Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP3-38241] -

Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP3-38241] - Immunofluorescence analysis of HeLa cells using Arginyl tRNA synthetase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Arginyl tRNA synthetase Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:10 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Arginyl tRNA synthetase

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Arginyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Alternate Names

arginine tRNA ligase 1, cytoplasmic, Arginine--tRNA ligase, arginyl-tRNA synthetase, arginyl-tRNA synthetase, cytoplasmic, ArgRS, DALRD1, EC 6.1.1.19, MGC8641

Gene Symbol

RARS1

Additional Arginyl tRNA synthetase Products

Product Documents for Arginyl tRNA synthetase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Arginyl tRNA synthetase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Arginyl tRNA synthetase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Arginyl tRNA synthetase Antibody - BSA Free and earn rewards!

Have you used Arginyl tRNA synthetase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...