ASCC3L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87044

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of ASCC3L1. Peptide sequence: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ASCC3L1 Antibody - BSA Free

Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044] - WB Suggested Anti-SNRNP200 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole Cell
Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044]

Western Blot: ASCC3L1 Antibody [NBP2-87044] - Host: Rabbit. Target Name: SNRNP200. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Applications for ASCC3L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASCC3L1

Putative RNA helicase involved in the second step of RNA splicing. May promote one or more conformational changes in the dynamic network of RNA-RNA interactions in the spliceosome. Appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices

Alternate Names

ASCC3L1, BRR2, BRR2 homolog, FLJ11521, HELIC2, KIAA0788, RP33, small nuclear ribonucleoprotein 200kDa (U5), U5 small nuclear ribonucleoprotein 200 kDa helicase, U5 snRNP-specific 200 kDa protein, U5-200KD

Gene Symbol

SNRNP200

Additional ASCC3L1 Products

Product Documents for ASCC3L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASCC3L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASCC3L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASCC3L1 Antibody - BSA Free and earn rewards!

Have you used ASCC3L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...