ASCL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92741

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3). METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ASCL4 Antibody - BSA Free

Western Blot: ASCL4 AntibodyAzide and BSA Free [NBP2-92741]

Western Blot: ASCL4 AntibodyAzide and BSA Free [NBP2-92741]

Western Blot: ASCL4 Antibody [NBP2-92741] - Analysis of extracts of various cell lines, using ASCL4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human lung cancer using ASCL4 antibody at dilution of 1:100 (40x lens)..
Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human appendix using ASCL4 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]

Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human breast cancer using ASCL4 antibody at dilution of 1:100 (40x lens).
ASCL4 Antibody - BSA Free

Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -

Inhibition of TRIM72 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with sh-TRIM72, with sh-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of TRIM72, ASCL4, GPX4, and FTH1 expressions in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ASCL4 Antibody - BSA Free

Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -

Overexpression of RBM15 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with oe-RBM15, with oe-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of RBM15, TRIM72, ASCL4, GPX4, and FTH1 in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ASCL4 Antibody - BSA Free

Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -

Overexpression of ADAM9 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with oe-ADAM9, with oe-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of ADAM9, ASCL4, GPX4, and FTH1 expressions in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ASCL4 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:50-1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ASCL4

Alternate Names

achaete-scute complex homolog 4 (Drosophila), bHLHa44, class A basic helix-loop-helix protein 44, class II bHLH protein ASCL4

Gene Symbol

ASCL4

Additional ASCL4 Products

Product Documents for ASCL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASCL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for ASCL4 Antibody - BSA Free

Customer Reviews for ASCL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASCL4 Antibody - BSA Free and earn rewards!

Have you used ASCL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...