ASRGL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38759

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ASRGL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP2-38759 (A) shows similar protein distribution across tissues to independent antibody NBP1-89133 (B).
Western Blot: ASRGL1 Antibody [NBP2-38759]

Western Blot: ASRGL1 Antibody [NBP2-38759]

Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ASRGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Western Blot: ASRGL1 Antibody [NBP2-38759]

Western Blot: ASRGL1 Antibody [NBP2-38759]

Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759]

Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.

Applications for ASRGL1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASRGL1

ASRGL1 acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as anexcitatory neurotransmitter in some brain regions

Alternate Names

ALP1, ALPL-asparagine amidohydrolase, asparaginase like 1, asparaginase-like 1 protein, Asparaginase-like protein 1, CRASH, EC 3.5.1.1, FLJ22316, L-asparaginase

Gene Symbol

ASRGL1

UniProt

Additional ASRGL1 Products

Product Documents for ASRGL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASRGL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASRGL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASRGL1 Antibody - BSA Free and earn rewards!

Have you used ASRGL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...