ASXL1 Antibody (6E2) - Azide and BSA Free
Novus Biologicals | Catalog # H00171023-M05
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Western Blot, ELISA, Immunoprecipitation
Cited:
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 6E2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for ASXL1 Antibody (6E2) - Azide and BSA Free
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05]
ASXL1-Antibody-6E2-Western-Blot-H00171023-M05-img0006.jpgWestern Blot: ASXL1 Antibody (6E2) [H00171023-M05]
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).ELISA: ASXL1 Antibody (6E2) [H00171023-M05]
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] -
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction(A) Evaluation of ASXL1 protein expression by WB. Left: ASXL1 protein expression in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), & KBM5 clones (labeled 1–5) w/ heterozygous precise correction of ASXL1 mutation. Right: ASXL1 protein expression in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, & KBM5 clones (labeled 1–5) w/ homozygous precise correction of ASXL1 mutation. beta -actin used as loading control. (B) Evaluation of expression levels of HOXA genes using quantitative real-time PCR (q-RT-PCR). Expression levels of HOXA5, 6, 7, 9, 10 & 13 measured in three ASXL1 homozygous corrected KBM5 clones compared w/ uncorrected cells. Results shown obtained from six independent experiments for each clone. Values in ASXL1 homozygous corrected cells are relative to uncorrected cells. Bar graphs show mean + standard error of mean (s.e.m.) (* = P < 0.05, ** = P < 0.01, *** = P < 0.001, paired t-test). (C) Evaluation of H3K27me3 levels & expression of PRC2 components by WB in uncorrected KBM5 cells & three KBM5 clones w/ homozygous correction of ASXL1 mutation. H3K27me3 levels & total H3 levels evaluated using purified histone fractions. Expression levels of two PRC2 components (EZH2, SUZ12) determined using whole cell lysates. beta -actin used as loading control. (D) Immunoprecipitation of BAP1 in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, & three KBM5 clones w/ homozygous correction of ASXL1 mutation. The BAP1 protein fraction immunoprecipitated using a BAP1 antibody & stained for ASXL1 & BAP1. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.6392), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] -
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction(A) Evaluation of ASXL1 protein expression by WB. Left: ASXL1 protein expression in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), & KBM5 clones (labeled 1–5) w/ heterozygous precise correction of ASXL1 mutation. Right: ASXL1 protein expression in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, & KBM5 clones (labeled 1–5) w/ homozygous precise correction of ASXL1 mutation. beta -actin used as loading control. (B) Evaluation of expression levels of HOXA genes using quantitative real-time PCR (q-RT-PCR). Expression levels of HOXA5, 6, 7, 9, 10 & 13 measured in three ASXL1 homozygous corrected KBM5 clones compared w/ uncorrected cells. Results shown obtained from six independent experiments for each clone. Values in ASXL1 homozygous corrected cells are relative to uncorrected cells. Bar graphs show mean + standard error of mean (s.e.m.) (* = P < 0.05, ** = P < 0.01, *** = P < 0.001, paired t-test). (C) Evaluation of H3K27me3 levels & expression of PRC2 components by WB in uncorrected KBM5 cells & three KBM5 clones w/ homozygous correction of ASXL1 mutation. H3K27me3 levels & total H3 levels evaluated using purified histone fractions. Expression levels of two PRC2 components (EZH2, SUZ12) determined using whole cell lysates. beta -actin used as loading control. (D) Immunoprecipitation of BAP1 in SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, & three KBM5 clones w/ homozygous correction of ASXL1 mutation. The BAP1 protein fraction immunoprecipitated using a BAP1 antibody & stained for ASXL1 & BAP1. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.6392), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ASXL1 Antibody (6E2) - Azide and BSA Free
Application
Recommended Usage
ELISA
1:100-1:2000
Western Blot
1:100-1:2000
Application Notes
This antibody is useful for ELISA, Western Blot. Use in immunoprecipitation reported in scientific literature (PMID: 24894717).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ASXL1
Additional ASXL1 Products
Product Documents for ASXL1 Antibody (6E2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ASXL1 Antibody (6E2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ASXL1 Antibody (6E2) - Azide and BSA Free
Customer Reviews for ASXL1 Antibody (6E2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ASXL1 Antibody (6E2) - Azide and BSA Free and earn rewards!
Have you used ASXL1 Antibody (6E2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Immunoprecipitation Protocol
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...