ATP5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92928

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP5A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ATP5A1 (NP_004037.1). MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP5A Antibody - BSA Free

ATP5A Antibody

Simple Western: ATP5A Antibody [NBP2-92928] -

Simple Western: ATP5A Antibody [NBP2-92928] - ATP5A Antibodies (NBP2-92928), ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times. Image from verified customer review.
Western Blot: ATP5A AntibodyBSA Free [NBP2-92928]

Western Blot: ATP5A AntibodyBSA Free [NBP2-92928]

Western Blot: ATP5A Antibody [NBP2-92928] - Analysis of extracts of various cell lines, using ATP5A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
ATP5A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of Hela cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
ATP5A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of U-2OS cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

Applications for ATP5A Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:5000
Application Notes
See Simple Western Antibody Database for Simple Western validation

Reviewed Applications

Read 1 review rated 5 using NBP2-92928 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP5A

ATP5A encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the same protein have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16. [provided by RefSeq]

Long Name

ATP5A1

Alternate Names

ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 co, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5A, ATP5A1, ATP5AL2, ATP5AMOM2, ATPM, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, COXPD22, EC 3.6.3, EC 3.6.3.14, epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, MC5DN4A, MC5DN4B, mitochondrial ATP synthetase, oligomycin-resistant, MOM2, OMR, ORM, ORMATP synthase alpha chain, mitochondrial

Gene Symbol

ATP5F1A

Additional ATP5A Products

Product Documents for ATP5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATP5A Antibody - BSA Free

Customer Reviews for ATP5A Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ATP5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • ATP5A Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: human brain lysate
    Species: Human
    Verified Customer | Posted 04/06/2023
    ATP5A Antibodies NBP2-92928, ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times.
    ATP5A Antibody - BSA Free NBP2-92928
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies