ATP5H Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48906

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP5H Antibody - BSA Free

Western Blot: ATP5H Antibody [NBP2-48906]

Western Blot: ATP5H Antibody [NBP2-48906]

Western Blot: ATP5H Antibody [NBP2-48906] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906] - Staining of human liver.
Immunohistochemistry: ATP5H Antibody [NBP2-48906]

Immunohistochemistry: ATP5H Antibody [NBP2-48906]

Immunohistochemistry: ATP5H Antibody [NBP2-48906] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906] - Staining of human cerebral cortex, heart muscle, kidney and liver using Anti-ATP5H antibody NBP2-48906 (A) shows similar protein distribution across tissues to independent antibody NBP2-47545 (B).
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906] - Staining of human heart muscle.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906]

Immunohistochemistry-Paraffin: ATP5H Antibody [NBP2-48906] - Staining of human kidney.

Applications for ATP5H Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5H

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the F0 complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq]

Alternate Names

ATP synthase D chain, mitochondrial, ATP synthase subunit d, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d, ATP synthase, H+ transporting, mitochondrial F1F0, subunit d, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d, ATP5JD, ATPase subunit d, ATPQ, My032 protein

Gene Symbol

ATP5PD

Additional ATP5H Products

Product Documents for ATP5H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP5H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5H Antibody - BSA Free and earn rewards!

Have you used ATP5H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...