ATP5J2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84481

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATP5J2. Peptide sequence: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP5J2 Antibody - BSA Free

Western Blot: ATP5J2 Antibody [NBP2-84481]

Western Blot: ATP5J2 Antibody [NBP2-84481]

Western Blot: ATP5J2 Antibody [NBP2-84481] - Host: Rabbit. Target Name: ATP5J2. Sample Tissue: Human HT1080 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for ATP5J2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5J2

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the innermembrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalyticcore, F1, and the membrane-spanning component, F0, which comprises the proton channel. The catalytic portion ofmitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with astoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The protonchannel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the F0 complex.Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This genehas multiple pseudogenes. (provided by RefSeq)

Alternate Names

ATP synthase f chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2, ATP5JLATP synthase subunit f, mitochondrial, F1F0-type ATPase subunit f, F1Fo-ATP synthase complex Fo membrane domain f subunit, F1Fo-ATPase, F1Fo-ATPase synthase f subunit

Gene Symbol

ATP5MF

Additional ATP5J2 Products

Product Documents for ATP5J2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP5J2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5J2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5J2 Antibody - BSA Free and earn rewards!

Have you used ATP5J2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...