ATP6V0C Antibody (3C7J3)

Novus Biologicals | Catalog # NBP3-33451

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3C7J3
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001685.1).

Sequence:
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP6V0C Antibody (3C7J3)

ATP6V0C Antibody (3C7J3)

Western Blot: ATP6V0C Antibody (3C7J3) [NBP3-33451] -

Western Blot: ATP6V0C Antibody (3C7J3) [NBP3-33451] - Western blot analysis of various lysates, using ATP6V0C Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for ATP6V0C Antibody (3C7J3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP6V0C

ATP6V0C encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is part of the V0 domain. This gene had the previous symbols of ATP6C and ATP6L. [provided by RefSeq]

Alternate Names

ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATP6LVPPC, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, ATPL, H(+)-transporting two-sector ATPase, 16 kDa subunit, vacuolar ATP synthase 16 kDa proteolipid subunit, vacuolar H+ ATPase proton channel subunit, Vacuolar proton pump 16 kDa proteolipid subunit, VATL, V-ATPase 16 kDa proteolipid subunit, Vma3, V-type proton ATPase 16 kDa proteolipid subunit

Gene Symbol

ATP6V0C

Additional ATP6V0C Products

Product Documents for ATP6V0C Antibody (3C7J3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V0C Antibody (3C7J3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V0C Antibody (3C7J3)

There are currently no reviews for this product. Be the first to review ATP6V0C Antibody (3C7J3) and earn rewards!

Have you used ATP6V0C Antibody (3C7J3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...