ATP6V0D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54595

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33268671)

Specificity

This product is specific to Subunit or Isoform: d 2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP6V0D2 Antibody - BSA Free

Western Blot: ATP6V0D2 Antibody [NBP1-54595]

Western Blot: ATP6V0D2 Antibody [NBP1-54595]

Western Blot: ATP6V0D2 Antibody [NBP1-54595] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.
ATP6V0D2 Antibody - BSA Free

Western Blot: ATP6V0D2 Antibody - BSA Free [NBP1-54595] -

The lack of CD73 leads to increased osteoclastogenesis in vitro. (A) Osteoclast differentiation model in the presence of M-CSF and RANKL. (B) Protein expression with the respective (C) densitometry analysis of CD73 relative to the loading control beta -Tubulin during differentiation of osteoclasts (1–3 days). (D) Identification of activate osteoclasts using TRAP positive staining (upper panels) and Pit resorption assay (lower panels) between WT (left panels) and CD73−/− (right panels). Protein expression of (E) ATP6V0D2 and Cathepsin K in osteoclasts derived from WT or CD73−/− animals with the respective (F, G) densitometry analysis showing fold change relative to beta -tubulin or GAPDH as loading control. Measurements of (H) number of osteoclasts, (I) Osteoclast area (x 103 um), and (J) Osteoclast resorption pit area (x 105 um). Data are presented as mean +/- S.D. (*p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38152410), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ATP6V0D2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0D2

ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Alternate Names

ATP6D2, ATP6V0, ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, FLJ38708, Vacuolar proton pump subunit d 2, V-ATPase subunit d 2, VMA6, V-type proton ATPase subunit d 2

Gene Symbol

ATP6V0D2

UniProt

Additional ATP6V0D2 Products

Product Documents for ATP6V0D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V0D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATP6V0D2 Antibody - BSA Free

Customer Reviews for ATP6V0D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V0D2 Antibody - BSA Free and earn rewards!

Have you used ATP6V0D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...