Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
Reactivity Notes
Canine reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ATP6V1A Antibody - BSA Free
Western Blot: ATP6V1A Antibody [NBP2-55164]
Western Blot: ATP6V1A Antibody [NBP2-55164] - ATP6V1A levels in MDCK lysates probed by western blot. Rabbit anti-ATP6V1A (NBP2-55164) primary antibody was used at 1:1000 dilution overnight at 4C. Image from verified customer review.Immunocytochemistry/ Immunofluorescence: ATP6V1A Antibody [NBP2-55164]
Staining of human cell line U-2 OS shows localization to nucleus, cytosol & vesicles.Applications for ATP6V1A Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP2-55164 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ATP6V1A
Long Name
V-type proton ATPase catalytic subunit A
Alternate Names
ATP6A1, ATP6V1A1, EC 7.1.2.2, V-ATPase subunit A, VPP2
Gene Symbol
ATP6V1A
Additional ATP6V1A Products
Product Documents for ATP6V1A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ATP6V1A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ATP6V1A Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used ATP6V1A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: MDCK canine kidney epithelial cell lineSpecies: CanineVerified Customer | Posted 09/01/2022ATP6V1A levels in MDCK lysates probed by western blot. Rabbit anti-ATP6V1A (NBP2-55164) primary antibody was used at 1:1000 dilution overnight at 4C.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...