ATP6V1D Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88895

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V1D Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human kidney, liver, lymph node and testis using Anti-ATP6V1D antibody NBP1-88895 (A) shows similar protein distribution across tissues to independent antibody NBP2-49254 (B).
Western Blot: ATP6V1D Antibody [NBP1-88895]

Western Blot: ATP6V1D Antibody [NBP1-88895]

Western Blot: ATP6V1D Antibody [NBP1-88895] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human liver.
Western Blot: ATP6V1D Antibody [NBP1-88895]

Western Blot: ATP6V1D Antibody [NBP1-88895]

Western Blot: ATP6V1D Antibody [NBP1-88895] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human testis.
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895]

Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human kidney.

Applications for ATP6V1D Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1D

ATP6V1D encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes the V1 domain D subunit protein.

Alternate Names

ATP6M, ATPase, H+ transporting lysosomal, member M, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D, H(+)-transporting two-sector ATPase, subunit M, vacuolar ATP synthase subunit D, vacuolar H-ATPase subunit D, vacuolar proton pump D subunit, vacuolar proton pump delta polypeptide, Vacuolar proton pump subunit D, vacuolar proton-ATPase subunit D, VATDV-ATPase D subunit, V-ATPase 28 kDa accessory protein, V-ATPase subunit D, VMA8, V-type proton ATPase subunit D

Gene Symbol

ATP6V1D

Additional ATP6V1D Products

Product Documents for ATP6V1D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V1D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V1D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V1D Antibody - BSA Free and earn rewards!

Have you used ATP6V1D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...