ATPase Inhibitory Factor 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92891
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ATPase Inhibitory Factor 1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891]
Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP2-92891] - Analysis of U2OS cells using ATPase Inhibitory Factor 1 at dilution of 1:100. Blue: DAPI for nuclear staining.Immunoprecipitation: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] -
Immunoprecipitation: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] - Immunoprecipitation analysis of 300 ug extracts of K-562 cells using 3 ug [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb. Western blot was performed from the immunoprecipitate using [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb at a dilition of 1:3000.Western Blot: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] -
Western Blot: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] - Western blot analysis of lysates from wild type(WT) and ATPase Inhibitory Factor 1 knockout (KO) 293T(KO) cells, using [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Applications for ATPase Inhibitory Factor 1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:100
Immunoprecipitation
1:1000 - 1:5000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ATPase Inhibitory Factor 1
Alternate Names
ATP synthase inhibitor protein, ATPase inhibitor protein, ATPase inhibitor, mitochondrial, ATPase inhibitory factor 1, ATPIIF(1), ATPIP, IF1, Inhibitor of F(1)F(o)-ATPase, IP, MGC1167, MGC8898
Gene Symbol
ATP5IF1
Additional ATPase Inhibitory Factor 1 Products
Product Documents for ATPase Inhibitory Factor 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ATPase Inhibitory Factor 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ATPase Inhibitory Factor 1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ATPase Inhibitory Factor 1 Antibody - BSA Free and earn rewards!
Have you used ATPase Inhibitory Factor 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...