ATPase Na+/K+ beta 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10586

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_038201). Peptide sequence WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATPase Na+/K+ beta 2 Antibody - BSA Free

Western Blot: ATPase Na+/K+ beta 2 Antibody [NBP3-10586]

Western Blot: ATPase Na+/K+ beta 2 Antibody [NBP3-10586]

Western Blot: ATPase Na+/K+ beta 2 Antibody [NBP3-10586] - Western blot analysis using NBP3-10586 on Mouse Kidney as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ATPase Na+/K+ beta 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPase Na+/K+ beta 2

ATPase Na+/ K+ beta 2 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. [provided by RefSeq]

Long Name

Sodium/potassium-transporting ATPase subunit beta-2

Alternate Names

AMOG, ATP1B2

Gene Symbol

ATP1B2

Additional ATPase Na+/K+ beta 2 Products

Product Documents for ATPase Na+/K+ beta 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATPase Na+/K+ beta 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATPase Na+/K+ beta 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATPase Na+/K+ beta 2 Antibody - BSA Free and earn rewards!

Have you used ATPase Na+/K+ beta 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...